Source:
E.Coli
Catalog No.
ENZ-329
The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.
This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.
In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Description: Recombinant Human Secreted Phospholipase A2-X is manufactured with N-terminal fusion HisTag, is 15.5 kDa polypeptide containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag.
amino acid sequence: MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRA
EEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
Physical Appearance: Sterile Filtered lyophilized (freeze-dried) powder.
Formulation: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01 M Tris buffer pH 7.2. Reconstitution: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
Specificity:
The amino acid sequence of the recombinant human Secreted Phospholipase A2-X is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-X without signal sequence and activation peptide.
Purification Method: Single-step procedure using affinity Ni-NTA chromatography. Purity: >95% (SDS PAGE analyzed).
Reconstitution: Sterile filtered and lyophilized from 0.5 mg/ml in 0.01 M Tris buffer pH 7.2. Reconstitution: Add 0.2 ml of distilled water and let the lyophilized pellet dissolve completely.
Storage: Store lyophilized protein at -20蚓. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4蚓 for a limited period of time; it does not show any change after two weeks at 4蚓.
Stability/Shelf Life: The lyophilized protein remains stable until the expiry date when stored at -20蚓.
Applications: Western blotting
References: ?Murakami M, Kudo I. New phospholipase A(2) isozymes with a potential role in atherosclerosis. Curr Opin Lipidol. 2003 Oct; 14(5): 431-6.
?Touqui L, Alaoui-El-Azher M. Mammalian secreted phospholipases A2 and their pathophysiological significance in inflammatory diseases. Curr Mol Med. 2001 Dec; 1(6): 739-54. Review.
Usage: This material is offered by ProSpec-TechnoGene for research, laboratory or further evaluation purposes.
Gene:
Name:PLA2G10
Group X secretory phospholipase A2 precursor (EC 3.1.1.4)
(Phosphatidylcholine 2-acylhydrolase GX)
(GX sPLA2)
(sPLA2-X).
Belongs to the phospholipase A2 family.
Domains:
•IPR013090 Phospholipase A2, active site
•IPR001211 Phospholipase A2
•Recombinant Human Secreted Phospholipase A2-IB
•Recombinant Human Secreted Phospholipase A2-V
•Recombinant Human Secreted Phospholipase A2-IIA
•Recombinant Human Secreted Phospholipase A2-IID
•Recombinant Human Secreted Phospholipase A2-IIE
•Recombinant Phospholipase A2 Bee Venom Protein
•Recombinant Human Secreted Phospholipase A2-XII
