Certificate of Analysis and Data Sheet
Source:
E.Coli
Catalog No.
ENZ-327
Background:
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane
glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.
The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.
This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso-PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.
In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Description:
Recombinant Human Secreted Phospholipase A2-IIE manufactured with N-terminal His-Tag is a 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues.
amino acid sequence:
MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYG
RLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC
Physical Appearance:
Sterile Filtered lyophilized (freeze-dried) powder.
Formulation:
Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH4.
Specificity:
The amino acid sequence of the recombinant human Secreted Phospholipase A2-IIE is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-IIE without signal sequence.
Purification Method:
Ni-NTA affinity chromatography.
Purity:
>95% (SDS PAGE analyzed).
Reconstitution:
Add 0.2 ml of 0.1M Acetate buffer pH4 and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10μg/ml. In higher concentrations the solubility of this antigen is limited.
Storage:
Store lyophilized protein at -20蚓. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4蚓 for a limited period of time; it does not show any change after two weeks at 4蚓.
Stability/Shelf Life:
The lyophilized protein remains stable until the expiry date when stored at -20蚓.
Applications:
Western blotting
References:
?Murakami M, Kudo I. New phospholipase A(2) isozymes with a potential role in atherosclerosis. Curr Opin Lipidol. 2003 Oct; 14(5): 431-6.
?Touqui L, Alaoui-El-Azher M. Mammalian secreted phospholipases A2 and their pathophysiological significance in inflammatory diseases. Curr Mol Med. 2001 Dec; 1(6): 739-54. Review.
?Valentin E, Ghomashchi F, Gelb MH, Lazdunski M, Lambeau G. On the diversity of secreted phospholipases A(2). Cloning, tissue distribution, and functional expression of two novel mouse group II enzymes. J Biol Chem. 1999 Oct; 274(44): 31195-202. Erratum in: J Biol Chem 2000 Jan
275(3): 2246.
Usage:
This material is offered by ProSpec-TechnoGene for research,
laboratory or further evaluation purposes.
Gene:
Name:PLA2G2E
Protein synonyms/aliases:
Group IIE secretory phospholipase A2 precursor (EC 3.1.1.4)
(Phosphatidylcholine 2-acylhydrolase GIIE)
(GIIE sPLA2)
(sPLA(2)-IIE).
Protein Family:
Belongs to the phospholipase A2 family.
Protein Domains:
Domains:
•IPR013090 Phospholipase A2, active site
•IPR001211 Phospholipase A2
Related proteins:
•Recombinant Human Secreted Phospholipase A2-IB
•Recombinant Human Secreted Phospholipase A2-V
•Recombinant Human Secreted Phospholipase A2-IIA
•Recombinant Human Secreted Phospholipase A2-IID
•Recombinant Human Secreted Phospholipase A2-X
•Recombinant Phospholipase A2 Bee Venom Protein
•Recombinant Human Secreted Phospholipase A2-XII
Protein links: