Certificate of Analysis and Data Sheet
Source:
E.Coli
Catalog No.
CYT-310
Background:
MIA acts as a potent tumor cell growth inhibitor for malignant melanoma cells and some other neuroectodermal tumors,
including gliomas, in an autocrine fashion.
In a study of human melanoma cell lines with different metastatic capacity MIA mRNA expression appeared to be inversely correlated
with pigmentation. MIA has been shown to represent a very sensitive and specific serum marker for systemic malignant melanoma that might be useful
for staging of primary melanomas,
detection of progression from localized to metastatic disease during follow-up, and monitoring therapy of advanced melanomas.
Description :
Recombinant Human MIA produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.
The Melanoma Inhibitory protein (MIA) was identified as an inhibitor of in vitro growth of malignant melanoma cells. The protein contains a SH3 domain.
Human Melanoma Inhibitory protein is purified by proprietary chromatographic techniques.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:
Recombinant MIA was lyophilized from a concentrated (1mg/ml) solution containing 20mM
Potassium-phosphate pH=7 and 150mM potassium chloride.
Solubility:
It is recommended to reconstitute the lyophilized Human MIA in sterile 18MO-cm
H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability:
Lyophilized Recombinant MIA although stable at room temperature for 3 weeks, should be stored desiccated
below -18 C. Upon reconstitution Recombinant MIA should be stored at 4 C between 2-7 days and for future use
below -18 C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please avoid freeze-thaw cycles.
Purity:
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Anion-exchange FPLC.
(c) Analysis by reducing and non-reducing SDS-PAGE Silver Stained gel.
Amino acid sequence:
Agrees with the sequence of native human MIA with an addition N-terminal Methionine residue.
MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKTDKWDFYCQ
Dimers and aggregates:
Less than 1% as determined by silver-stained SDS-PAGE gel analysis.
Protein content:
Protein quantitation was carried out by two independent methods:
1. UV spectroscopy at 280 nm using the absorbption coefficient of 19300 M
-1cm
-1 .
2. Analysis by RP-HPLC, using a calibrated solution of MIA as a Reference Standard.
Endotoxin:
Less than 0.1 ng/ug (IEU/ug) of Human MIA.
Usage:
This material is offered by ProSpec-TechnoGene for research,
laboratory or further evaluation purposes.
Gene:
Name:MIA
Protein synonyms/aliases:
Melanoma derived growth regulatory protein precursor (Melanomainhibitory activity).
Protein Family:
Belongs to the MIA/OTOR family.
Protein Domains:
Domains:
•IPR011511 Variant SH3
•IPR001452 Src homology-3
Protein links: